PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_23496_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family NAC
Protein Properties Length: 233aa    MW: 27247.7 Da    PI: 9.4398
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_23496_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM140.88e-44421752128
                                  NAM   2 ppGfrFhPtdeelvveyLkkkvegkk...leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkky 68 
                                          +pGfrF Pt+eelv++yL+kk+e++    + l++vi+ ++iy++ePw Lpk     +++++++w+fF++r++++
  cra_locus_23496_iso_1_len_726_ver_3  42 QPGFRFYPTEEELVSFYLRKKLEENIrepNLLDRVIPVIHIYEFEPWLLPKlsgeLCSGDSEQWFFFVPRQERE 115
                                          69********************9987664444567***************656653444677************ PP

                                  NAM  69 atgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                          a+g r+nr+t+sgyWkatg+ + v+s++++++g+kk++vfy+g+ap+g+kt+W m+eyr+
  cra_locus_23496_iso_1_len_726_ver_3 116 ARGGRPNRTTASGYWKATGSPNYVYSSNNRVIGVKKSMVFYRGKAPTGKKTTWKMNEYRA 175
                                          **********************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-4838203IPR003441NAC domain
PROSITE profilePS5100547.68441205IPR003441NAC domain
PfamPF023657.8E-2543174IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
XAGGLKAREN NIHTNQFAYI DFMDMQQQED QKQKEIKLVE FQPGFRFYPT EEELVSFYLR  60
KKLEENIREP NLLDRVIPVI HIYEFEPWLL PKLSGELCSG DSEQWFFFVP RQEREARGGR  120
PNRTTASGYW KATGSPNYVY SSNNRVIGVK KSMVFYRGKA PTGKKTTWKM NEYRAIEEQI  180
LPSSSSAQPI PKLRHELSLC RVYIISGSCR AFDRRPLWTE TRRLGEIAQD FSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-35312037163NAC domain-containing protein 19
4dul_A5e-35312037163NAC domain-containing protein 19
1ut7_B5e-35312037163NO APICAL MERISTEM PROTEIN
1ut7_A5e-35312037163NO APICAL MERISTEM PROTEIN
1ut4_B5e-35312037163NO APICAL MERISTEM PROTEIN
1ut4_A5e-35312037163NO APICAL MERISTEM PROTEIN
3swp_D6e-353120310166NAC domain-containing protein 19
3swp_C6e-353120310166NAC domain-containing protein 19
3swp_B6e-353120310166NAC domain-containing protein 19
3swp_A6e-353120310166NAC domain-containing protein 19
3swm_D6e-353120310166NAC domain-containing protein 19
3swm_C6e-353120310166NAC domain-containing protein 19
3swm_B6e-353120310166NAC domain-containing protein 19
3swm_A6e-353120310166NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362874.12e-95PREDICTED: NAC domain-containing protein 90-like
RefseqXP_009759500.11e-95PREDICTED: NAC domain-containing protein 90
RefseqXP_016443705.11e-95PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR37e-82NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A068UEA72e-95A0A068UEA7_COFCA; Uncharacterized protein
TrEMBLQ9SXQ01e-95Q9SXQ0_TOBAC; NAC-domain protein
STRINGPGSC0003DMT4000677077e-95(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357